PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018418
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB
Protein Properties Length: 334aa    MW: 37096.3 Da    PI: 6.0965
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018418genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEde+l d+++ +G g+W+t ++  g+ R++k+c++rw +yl
      Lus10018418 14 KGPWTSEEDEKLMDYIRDHGYGNWRTLPKNAGLQRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.51.3e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
      Lus10018418  67 RGRFSSEEEEAIIQLHSVLGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.713961IPR017930Myb domain
SuperFamilySSF466899.54E-3111108IPR009057Homeodomain-like
SMARTSM007171.0E-111363IPR001005SANT/Myb domain
PfamPF002497.8E-151461IPR001005SANT/Myb domain
CDDcd001673.08E-111661No hitNo description
PROSITE profilePS5129426.75562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.2E-2765116IPR009057Homeodomain-like
SMARTSM007173.0E-1666114IPR001005SANT/Myb domain
PfamPF002491.4E-1567111IPR001005SANT/Myb domain
CDDcd001672.22E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGRSPCCEKN GLKKGPWTSE EDEKLMDYIR DHGYGNWRTL PKNAGLQRCG KSCRLRWTNY  60
LRPDIKRGRF SSEEEEAIIQ LHSVLGNKWS AIAARLPGRT DNEIKNYWNT HIRKKLLRMG  120
IDPVTHSPRL DLLDLSSILS SSFSSSSHLM NFSGMVDGVV QPLINPEILR LAASLFSTSR  180
GAAQPENQNF ISSNQSLVQP VGHELHQELT ATTTITTNMP CGQFSAIDAQ SMVPTDWQSN  240
YTDGYDLHNG VQQPGRYYYG SSPDNIVGPS TESGFGIPPA SVLSTPSSSP TPLNSSSTYN  300
NWNSSTEDER DSYSSDVFRF EIPDCILDVS NFM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-31121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006449197.11e-127hypothetical protein CICLE_v10015729mg
TrEMBLV4U8Y81e-127V4U8Y8_9R
STRINGGLYMA15G07230.11e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.11e-101MYB-like 102